PeptideYY(3-36),human

Peptide YY (3-36) is a Y2 receptor antagonist. It reduces food intake and modulates brain activity in the appetite centers in humans.

Online Inquiry

CAT#R1849
CAS123583-37-9
Synonyms/AliasPYY; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine
M.F/FormulaC180H279N53O54
M.W/Mr.4049.55
SequenceOne Letter Code: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide)
Three Letter Code: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Purity≥95%
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.