1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. PeptideYY(3-36),human

PeptideYY(3-36),human

Peptide YY (3-36) is a Y2 receptor antagonist. It reduces food intake and modulates brain activity in the appetite centers in humans.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
PeptideYY(3-36),human(CAS 123583-37-9)

CAT No: R1849

CAS No:123583-37-9

Synonyms/Alias:UNII-7PQZ90ULIR;123583-37-9;peptide YY-3;PYY-3 peptide;Pyy (3-36) peptide;7PQZ90ULIR;Peptide YY (3-36) (human) trifluoroacetate salt;Peptide YG (Lophius americanus pancreatic islet), 1-de-L-tyrosine-2-de-L-proline-3-L-isoleucine-7-L-alanine-10-L-glutamic acid-11-L-aspartic acid-16-L-glutamic acid-17-L-leucine-18-L-asparagine-19-L-arginine-21-L-tyrosine-23-L-serine-24-L-leucine-28-L-leucine-31-L-valine-36-L-tyrosinamide-37-deglycine;peptide YY3-36;human peptide YY (3-36);Peptide YY Human (3-36);SCHEMBL13248707;Gt-001;AKOS032949725;PEPTIDE YY (3-36) [MI];DA-76727;FP110326;H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Ar g-Tyr-NH2; H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;Ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C180H279N53O54
M.W/Mr.
4049
Sequence
One Letter Code:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Three Letter Code:H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Purity
≥95%
Long-term Storage Conditions
Soluble in water (1 mg/ml), DMSO.
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI
InChI=1S/C180H279N53O54/c1-17-91(12)141(185)171(282)214-114(27-18-19-61-181)175(286)232-67-25-33-130(232)169(280)211-111(53-58-137(247)248)147(258)204-94(15)174(285)231-66-24-32-129(231)168(279)200-82-135(244)205-109(52-57-136(245)246)152(263)226-126(80-140(253)254)157(268)203-93(14)146(257)228-128(84-235)176(287)233-68-26-34-131(233)170(281)212-113(55-60-139(251)252)154(265)210-112(54-59-138(249)250)155(266)216-117(70-87(4)5)159(270)224-124(78-133(183)242)164(275)208-106(29-21-63-197-178(189)190)150(261)220-121(75-98-39-47-103(239)48-40-98)162(273)221-120(74-97-37-45-102(238)46-38-97)156(267)202-92(13)145(256)227-127(83-234)167(278)219-116(69-86(2)3)158(269)207-107(30-22-64-198-179(191)192)151(262)223-123(77-100-81-195-85-201-100)163(274)222-122(76-99-41-49-104(240)50-42-99)161(272)217-118(71-88(6)7)160(271)225-125(79-134(184)243)165(276)218-119(72-89(8)9)166(277)229-142(90(10)11)172(283)230-143(95(16)236)173(284)213-108(31-23-65-199-180(193)194)148(259)209-110(51-56-132(182)241)153(264)206-105(28-20-62-196-177(187)188)149(260)215-115(144(186)255)73-96-35-43-101(237)44-36-96/h35-50,81,85-95,105-131,141-143,234-240H,17-34,51-80,82-84,181,185H2,1-16H3,(H2,182,241)(H2,183,242)(H2,184,243)(H2,186,255)(H,195,201)(H,200,279)(H,202,267)(H,203,268)(H,204,258)(H,205,244)(H,206,264)(H,207,269)(H,208,275)(H,209,259)(H,210,265)(H,211,280)(H,212,281)(H,213,284)(H,214,282)(H,215,260)(H,216,266)(H,217,272)(H,218,276)(H,219,278)(H,220,261)(H,221,273)(H,222,274)(H,223,262)(H,224,270)(H,225,271)(H,226,263)(H,227,256)(H,228,257)(H,229,277)(H,230,283)(H,245,246)(H,247,248)(H,249,250)(H,251,252)(H,253,254)(H4,187,188,196)(H4,189,190,197)(H4,191,192,198)(H4,193,194,199)/t91-,92-,93-,94-,95+,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,141-,142-,143-/m0/s1
InChI Key
AUHJXHCVECGTKR-DQNUUZSMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide CDMOPeptide Modification ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicescGMP Peptide Service
Hot Products
Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Read More Read More
Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) Acetate is a radiolabeled peptide for tumor imaging and targeting research. Purchase this high-purity peptide for oncology and diagnostic studies.

Read More Read More
Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers