PeptideYY(3-36),human

Peptide YY (3-36) is a Y2 receptor antagonist. It reduces food intake and modulates brain activity in the appetite centers in humans.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
PeptideYY(3-36),human(CAS 123583-37-9)

CAT No: R1849

CAS No:123583-37-9

Synonyms/Alias:UNII-7PQZ90ULIR;123583-37-9;peptide YY-3;PYY-3 peptide;Pyy (3-36) peptide;7PQZ90ULIR;Peptide YY (3-36) (human) trifluoroacetate salt;Peptide YG (Lophius americanus pancreatic islet), 1-de-L-tyrosine-2-de-L-proline-3-L-isoleucine-7-L-alanine-10-L-glutamic acid-11-L-aspartic acid-16-L-glutamic acid-17-L-leucine-18-L-asparagine-19-L-arginine-21-L-tyrosine-23-L-serine-24-L-leucine-28-L-leucine-31-L-valine-36-L-tyrosinamide-37-deglycine;peptide YY3-36;human peptide YY (3-36);Peptide YY Human (3-36);SCHEMBL13248707;Gt-001;AKOS032949725;PEPTIDE YY (3-36) [MI];DA-76727;FP110326;H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Ar g-Tyr-NH2; H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2;Ile-lys-pro-glu-ala-pro-gly-glu-asp-ala-ser-pro-glu-glu-leu-asn-arg-tyr-tyr-ala-ser-leu-arg-his-tyr-leu-asn-leu-val-thr-arg-gln-arg-tyr-nh2;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C180H279N53O54
M.W/Mr.
4049
Sequence
One Letter Code:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Three Letter Code:H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Purity
≥95%

PeptideYY(3-36), human is a biologically active peptide fragment derived from the larger peptide YY, a member of the pancreatic polypeptide family. This 34-amino acid sequence, naturally produced in the gastrointestinal tract, plays a significant role in regulating appetite, energy balance, and digestive processes through its interaction with specific Y receptors, particularly Y2. Its selective affinity and receptor-mediated signaling make it a valuable research tool in metabolic studies, neuroendocrinology, and gastrointestinal physiology. The human variant of PeptideYY(3-36) is especially relevant for translational research aiming to elucidate mechanisms underlying human metabolic regulation and gut-brain axis communication.

Metabolic Regulation Studies: Peptide YY(3-36) is widely employed in investigations focused on appetite control, satiety signaling, and energy homeostasis. By acting as a potent agonist at the Y2 receptor, it provides a model system for dissecting the neuroendocrine pathways that govern feeding behavior and caloric intake. Researchers utilize this peptide to examine how gut-derived signals modulate hypothalamic circuits, supporting the development of foundational knowledge regarding the physiological regulation of food consumption and energy expenditure.

Neuroendocrine Function Analysis: The peptide serves as a critical reagent in studies exploring the interactions between the gastrointestinal system and the central nervous system. Its ability to cross the blood-brain barrier and influence neuronal activity enables detailed analysis of gut-brain communication pathways. Through in vitro and in vivo experimental models, scientists use Peptide YY(3-36) to map receptor distribution, characterize downstream signaling events, and investigate the integration of peripheral signals with central neuroendocrine responses.

Gastrointestinal Motility Research: In the context of digestive physiology, this peptide fragment is instrumental for probing the effects of endogenous peptides on gastrointestinal motility and secretion. Its modulatory action on smooth muscle contraction and secretion dynamics is leveraged to understand the coordination of digestive processes and the impact of peptide hormones on gut function. Such studies inform the broader field of enteric neuroscience and support the identification of regulatory checkpoints within the digestive tract.

Peptide Receptor Pharmacology: Peptide YY(3-36) is frequently used as a reference ligand in receptor binding assays and functional studies aimed at characterizing Y2 receptor pharmacodynamics. Its high selectivity and well-defined bioactivity make it suitable for competitive binding experiments, receptor activation analyses, and the screening of novel receptor modulators. These applications contribute to the elucidation of ligand-receptor interactions and the development of new molecular probes for neuropeptide research.

Peptide Synthesis and Analytical Validation: The human form of Peptide YY(3-36) is also utilized as a standard in peptide synthesis protocols and analytical method development. Its defined sequence and bioactivity profile provide a benchmark for validating synthetic strategies, optimizing purification workflows, and calibrating analytical instrumentation such as HPLC or mass spectrometry. This ensures the reliability and reproducibility of peptide-based research and supports quality control in peptide production environments.

Long-term Storage Conditions
Soluble in water (1 mg/ml), DMSO.
Shipping Condition
Wet ice in continental US; may vary elsewhere
InChI
InChI=1S/C180H279N53O54/c1-17-91(12)141(185)171(282)214-114(27-18-19-61-181)175(286)232-67-25-33-130(232)169(280)211-111(53-58-137(247)248)147(258)204-94(15)174(285)231-66-24-32-129(231)168(279)200-82-135(244)205-109(52-57-136(245)246)152(263)226-126(80-140(253)254)157(268)203-93(14)146(257)228-128(84-235)176(287)233-68-26-34-131(233)170(281)212-113(55-60-139(251)252)154(265)210-112(54-59-138(249)250)155(266)216-117(70-87(4)5)159(270)224-124(78-133(183)242)164(275)208-106(29-21-63-197-178(189)190)150(261)220-121(75-98-39-47-103(239)48-40-98)162(273)221-120(74-97-37-45-102(238)46-38-97)156(267)202-92(13)145(256)227-127(83-234)167(278)219-116(69-86(2)3)158(269)207-107(30-22-64-198-179(191)192)151(262)223-123(77-100-81-195-85-201-100)163(274)222-122(76-99-41-49-104(240)50-42-99)161(272)217-118(71-88(6)7)160(271)225-125(79-134(184)243)165(276)218-119(72-89(8)9)166(277)229-142(90(10)11)172(283)230-143(95(16)236)173(284)213-108(31-23-65-199-180(193)194)148(259)209-110(51-56-132(182)241)153(264)206-105(28-20-62-196-177(187)188)149(260)215-115(144(186)255)73-96-35-43-101(237)44-36-96/h35-50,81,85-95,105-131,141-143,234-240H,17-34,51-80,82-84,181,185H2,1-16H3,(H2,182,241)(H2,183,242)(H2,184,243)(H2,186,255)(H,195,201)(H,200,279)(H,202,267)(H,203,268)(H,204,258)(H,205,244)(H,206,264)(H,207,269)(H,208,275)(H,209,259)(H,210,265)(H,211,280)(H,212,281)(H,213,284)(H,214,282)(H,215,260)(H,216,266)(H,217,272)(H,218,276)(H,219,278)(H,220,261)(H,221,273)(H,222,274)(H,223,262)(H,224,270)(H,225,271)(H,226,263)(H,227,256)(H,228,257)(H,229,277)(H,230,283)(H,245,246)(H,247,248)(H,249,250)(H,251,252)(H,253,254)(H4,187,188,196)(H4,189,190,197)(H4,191,192,198)(H4,193,194,199)/t91-,92-,93-,94-,95+,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,141-,142-,143-/m0/s1
InChI Key
AUHJXHCVECGTKR-DQNUUZSMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Analysis ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers