CAT# | P15002 |
Sequence | IYCGFGGTVPAGDGCNFCFCTPLGTIGTCTMRRCDSLS |
Length | 38 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15012 | protease inhibitor PI-3 | Inquiry | ||
P15007 | protease inhibitor SGPI-5Bt | Inquiry | ||
P15015 | serine protease inhibitor pi-4A | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry | ||
P15017 | serine protease inhibitor pi-4Ca | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...