PNC-27 is a peptide construct developed to prevent the interaction of human HDM-2/mouse MDM-2 and p53.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4029.2 |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.