PNC-27 is a peptide construct developed to prevent the interaction of human HDM-2/mouse MDM-2 and p53.
CAT# | OPO-001 |
CAS | 1159861-00-3 |
M.W/Mr. | 4029.2 |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...