Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide
Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide
Pramlintide is a synthetic analogue of the Amylin(1-37) by replacing proline at positions 25, 28 and 29. Pramlintide has a disulfide bridge between C2 and C7.
Online Inquiry
| CAT# | A12017 |
| M.F/Formula | C171H269N51O53S2 |
| M.W/Mr. | 3949.6 |
| Sequence | One Letter Code: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge), acetate salt
Three-Letter Code: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate salt (S-S Bond) |
| Source# | human |
Storage | - 20 °C |
Write a review
Ask a question
My Review for Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide
Required fields are marked with *
×
Ask a Question for Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
