Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37) (human), Amide

Pramlintide is a synthetic analogue of the Amylin(1-37) by replacing proline at positions 25, 28 and 29. Pramlintide has a disulfide bridge between C2 and C7.

Online Inquiry

CAT#A12017
M.F/FormulaC171H269N51O53S2
M.W/Mr.3949.6
SequenceOne Letter Code: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge), acetate salt
Three-Letter Code: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate salt (S-S Bond)
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...

 NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...

Introduce of lipopeptide Lipopeptide (peptidolipid), also known as acylpeptide, is composed of hydrophilic peptide bond and l ...

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.