(Pro3) Gastric Inhibitory Peptide (GIP), human

(Pro3) Gastric Inhibitory Peptide (GIP), human features a proline substitution that perturbs local backbone flexibility. The conformational constraint introduced near the N-terminus provides insight into receptor-binding geometry. Researchers apply this analog to dissect structure-activity relationships of GIP. Its defined change enables detailed comparisons with native hormone fragments.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G02007

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H338N60O64S1
M.W/Mr.
4951.6
Sequence
YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Length
42

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOcGMP Peptide ServicePeptide Analysis ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers