Home > Product > Antimicrobial Peptides > Salivaricin P

Antimicrobial Peptides

Salivaricin P

Price Inquiry
CAT#
AF3153
Sequence
KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
Host Chemicals
Lactobacillus salivarius DPC6005
Length
45
Activity
Antimicrobial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.