Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC |
Activity | Gram+ & Gram-, Fungi, |
Host Chemicals | leaf, Spinacia oleracea |
Length | 52 |
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.