Tat-Beclin-1, scrambled

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. Tat-Beclin-1, scrambled will not induce autophagy and can be used as a negative control. RELATED PRODUCTS:Tat-Beclin-1, Cat# 65467Beclin-1, Cat# 65466

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: GR1215

Synonyms/Alias:Beclin-1 Activator I; TAT-Beclin-1, Scrambled; H?N-YGRKKRRQRRR-GG-VGNDFFINHETTGFATEW-CO?H;H-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH;YGRKKRRQRRRGGVGNDFFINHETTGFATEW-acid;H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val- Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-T hr-Thr-Gly-Phe-Ala-Thr-Glu-Trp-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C164H251N57O45
M.W/Mr.
3741.1
Sequence
One Letter Code: YGRKKRRQRRRGGVGNDFFINHETTGFATEW
Three-Letter Code: Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-His-Phe-Phe-Ile-Asn-His-Ser-Thr-Thr-Gly-Phe-Ala-Thr-Gln-Trp-OH
Purity
% Peak Area By HPLC ≥ 95%
Size
1 mg
References
Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012).

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide Synthesis ServicesCustom Conjugation ServicecGMP Peptide ServiceEpitope Mapping ServicesPeptide CDMOPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers