Keywords Search Google Search Search

WAM2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2508
Sequence	KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF108	Non-disulfide-bridged peptide 58	Inquiry
AF1465	Variacin	Inquiry
AF2635	Lividin-4	Inquiry
AF774	Ranalexin-1Ca	Inquiry
AF3168	Vicin-like antimicrobial peptide 2c-1	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Brief information and effect of bradykinin

Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

Montirelin: a thyrotropin-releasing hormone analogue

Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...

Desmopressin

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

Function of GsMTx4 in advanced atrial fibrillation

GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Macropus eugenii
Length	36