Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KRGLWESLKRKATKLGDDIRNTLRNFKIKFPVPRQG |
Activity | Antibacterial, Antifungal |
Host Chemicals | Macropus eugenii |
Length | 36 |
1. TMEM16F and dynamins control expansive plasma membrane reservoirs
5. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.