3X HA Tag

3X HA Tag contains three tandem HA epitopes used for affinity capture and immunodetection. Repeated aromatic and charged residues enhance antibody recognition. Researchers employ it in protein-labeling, pull-downs, and imaging assays. Applications include tagged-protein purification, detection optimization, and epitope mapping.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2841

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C205H272N38O67S
M.W/Mr.
4372.9
Sequence
One Letter Code:MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Three Letter Code:H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH

3X HA Tag is a synthetic peptide epitope sequence derived from the human influenza hemagglutinin (HA) protein, engineered to facilitate the detection, purification, and characterization of recombinant proteins in diverse biological research settings. Featuring three tandem repeats of the HA epitope, this tag significantly enhances the binding affinity to anti-HA antibodies, thereby improving the sensitivity and specificity of downstream applications. Its compact size and minimal interference with protein folding or function make it a popular choice for protein engineering, molecular biology, and cell biology studies. The 3X HA Tag is compatible with a wide range of expression systems, including mammalian, yeast, and bacterial hosts, supporting versatile experimental design and robust reproducibility across laboratories.

Protein Detection and Localization: In immunofluorescence and immunocytochemistry assays, the 3X HA Tag enables precise visualization of tagged proteins within cells. By fusing it to the protein of interest, researchers can leverage high-affinity anti-HA antibodies conjugated to fluorescent dyes, allowing for the accurate mapping of protein subcellular localization and trafficking pathways. The amplified signal provided by the triply repeated epitope enhances detection even for proteins expressed at low levels, making it a valuable tool in cellular imaging and protein dynamics studies.

Affinity Purification: The triple HA tag sequence is widely employed in affinity purification protocols for isolating recombinant proteins from complex lysates. Coupling anti-HA antibody-conjugated agarose or magnetic beads with tagged constructs allows for efficient and selective capture of target proteins, minimizing background and facilitating downstream analysis such as mass spectrometry, enzymatic assays, or structural studies. The enhanced binding capacity of the 3X HA Tag reduces the amount of antibody required and improves yield, streamlining the purification process for both analytical and preparative scales.

Protein-Protein Interaction Studies: The 3X HA Tag is instrumental in co-immunoprecipitation (co-IP) and pull-down assays aimed at elucidating protein-protein interactions. By tagging a bait protein with the HA epitope, researchers can efficiently capture and identify interacting partners from cell lysates using anti-HA antibodies. The increased affinity and specificity provided by the triple tag configuration reduce nonspecific binding and background, enabling clearer identification of interaction networks and contributing to the understanding of cellular signaling pathways and complex assembly.

Western Blot Analysis: In Western blotting, the 3X HA Tag offers reliable and sensitive detection of recombinant proteins through immunoblotting techniques. Its strong interaction with anti-HA antibodies ensures robust signal generation, even at low protein concentrations, facilitating quantitative and qualitative protein expression analyses. The tag's compatibility with a variety of antibody formats, including monoclonal and polyclonal reagents, supports flexible assay development tailored to specific research needs.

Chromatin Immunoprecipitation (ChIP): The application of the 3X HA Tag in ChIP assays enables the study of DNA-protein interactions in vivo. By fusing the tag to transcription factors or chromatin-associated proteins, researchers can utilize anti-HA antibodies to immunoprecipitate chromatin complexes, allowing for the identification of genomic binding sites and regulatory elements. This approach enhances the specificity and efficiency of ChIP experiments, facilitating insights into epigenetic regulation and gene expression control mechanisms.

Epitope Mapping and Antibody Validation: The 3X HA Tag serves as a standard epitope for calibrating and validating antibody reagents. By incorporating the tag into recombinant constructs, it is possible to assess antibody specificity, cross-reactivity, and performance in various assay formats. This application is crucial in the development of new antibody tools and in ensuring the reliability of immunoassays across research projects. The versatility and robust performance of the 3X HA Tag continue to drive its adoption in molecular and cellular biology, supporting advances in protein research and functional genomics.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide CDMOCustom Conjugation ServicecGMP Peptide ServicePeptide Analysis ServicesEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers