5FAM label LL 37 (human)

5FAM Label LL-37 (Human) attaches a fluorescein derivative to the human LL-37 antimicrobial peptide, enabling visualization of membrane binding and peptide diffusion. The labeling preserves core amphipathic structure while adding a sensitive optical reporter. Researchers track interactions with lipids, proteins, and extracellular matrices. Applications include fluorescence imaging, peptide-membrane studies, and mechanistic modeling.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2774

CAS No:2243219-81-8

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H350N60O59
M.W/Mr.
4851.56
Sequence
One Letter Code:{Fluorescein-5-carbonyl}[LL-37, 37 aa]
Three Letter Code:{Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

5FAM label LL 37 (human) is a synthetic peptide derived from the human cathelicidin antimicrobial peptide LL-37, conjugated at the N-terminus with the fluorescent dye 5-carboxyfluorescein (5-FAM). This labeled peptide combines the biologically active sequence of LL-37 with the sensitive detection capabilities of 5-FAM, enabling researchers to investigate the dynamics, localization, and interactions of LL-37 in a variety of experimental systems. The dual nature of this compound—retaining both the functional properties of the parent peptide and the fluorescence of the 5-FAM tag—makes it a valuable tool for advanced studies in immunology, cell biology, and peptide biochemistry.

Fluorescence-based binding assays: The 5FAM-labeled LL-37 peptide is widely utilized in fluorescence-based binding studies to characterize its interactions with cellular membranes, microbial surfaces, or molecular targets such as lipopolysaccharides or nucleic acids. The 5-FAM fluorophore enables sensitive, real-time monitoring of peptide binding events using fluorescence spectroscopy, flow cytometry, or confocal microscopy, providing quantitative and spatially resolved insights into the mechanisms by which LL-37 engages with its targets in vitro.

Cellular uptake and localization studies: Researchers employ the labeled peptide to visualize and quantify cellular uptake and subcellular distribution of LL-37 in mammalian or microbial cells. Using fluorescence microscopy or flow cytometry, the 5FAM tag allows for precise tracking of the peptide's internalization pathways, accumulation sites, and trafficking dynamics within living cells, facilitating studies on peptide-mediated immune modulation, endocytosis, and intracellular signaling.

Membrane interaction and permeabilization analysis: The amphipathic nature of LL-37 underlies its interaction with lipid bilayers, a property critical to its antimicrobial and immunomodulatory functions. By leveraging the fluorescence of the 5FAM tag, researchers can investigate the peptide's membrane-binding affinity, insertion depth, and capacity to induce membrane permeabilization or disruption. Such assays often employ model membranes, vesicles, or supported bilayers to elucidate the biophysical mechanisms underlying LL-37's biological activity.

Peptide trafficking and biodistribution research: The fluorescently labeled peptide serves as a powerful tracer for studying the biodistribution, tissue penetration, and clearance of LL-37 analogs in ex vivo tissue models or advanced in vitro systems such as organoids. The 5FAM label permits non-destructive, time-resolved tracking of the peptide within complex biological matrices, supporting research into peptide delivery, stability, and bioavailability under physiologically relevant conditions.

High-throughput screening and assay development: The robust fluorescence properties of the 5FAM-labeled LL-37 peptide make it suitable for the development of high-throughput assays aimed at identifying modulators of peptide activity, binding partners, or inhibitors of LL-37-mediated pathways. Its compatibility with multiwell plate formats and automated detection systems enables efficient screening of compound libraries, antibody panels, or peptide variants, thereby accelerating discovery workflows in antimicrobial research and innate immunity.

Overall, the 5FAM label LL 37 (human) peptide provides a versatile and reliable platform for probing the multifaceted roles of LL-37 in biological systems, supporting a wide spectrum of experimental approaches that benefit from the integration of fluorescence-based detection with peptide biochemistry. Its utility spans from fundamental mechanistic studies to applied research in peptide-membrane interactions and innate immune function.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers