5FAM label LL 37 (human)

5FAM Label LL-37 (Human) attaches a fluorescein derivative to the human LL-37 antimicrobial peptide, enabling visualization of membrane binding and peptide diffusion. The labeling preserves core amphipathic structure while adding a sensitive optical reporter. Researchers track interactions with lipids, proteins, and extracellular matrices. Applications include fluorescence imaging, peptide-membrane studies, and mechanistic modeling.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2774

CAS No:2243219-81-8

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H350N60O59
M.W/Mr.
4851.56
Sequence
One Letter Code:{Fluorescein-5-carbonyl}[LL-37, 37 aa]
Three Letter Code:{Fluorescein-5-carbonyl}-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

5FAM label LL 37 (human) represents a fusion of the well-characterized human antimicrobial peptide LL-37 with the highly sensitive 5-carboxyfluorescein (5FAM) fluorescent label. This innovative conjugate enables advanced visualization and quantification of LL-37's dynamic interactions in various biological systems. By attaching the 5FAM fluorophore, researchers can monitor peptide localization, binding events, and functional assays with exceptional clarity and minimal perturbation to the peptide's native activity. The labeled peptide maintains the functional characteristics of LL-37, such as its cationic charge and amphipathic structure, while providing a robust signal for fluorescence-based applications. As a result, 5FAM-labeled LL-37 is a versatile tool for exploring the multifaceted roles of this peptide in host defense, cell signaling, and molecular recognition.

Antimicrobial Mechanism Studies: 5FAM-labeled LL-37 is widely used to elucidate the mechanisms by which LL-37 interacts with bacterial membranes and disrupts microbial integrity. By utilizing the strong fluorescence of the 5FAM tag, researchers can track the peptide's binding to bacterial surfaces, monitor its insertion into lipid bilayers, and visualize real-time membrane permeabilization events using confocal microscopy or flow cytometry. These studies provide insights into the selective targeting of pathogens by LL-37 and help distinguish between direct lytic activity and more subtle membrane-modulatory effects. The ability to observe the spatial and temporal dynamics of peptide-membrane interactions is critical for understanding the molecular basis of innate immune defense and for designing new antimicrobial strategies inspired by LL-37's mode of action.

Cellular Uptake and Localization: The fluorescently labeled LL-37 is a powerful probe for investigating peptide internalization and intracellular trafficking in mammalian cells. Researchers employ 5FAM-labeled LL-37 to delineate the pathways of endocytosis, identify subcellular compartments involved in peptide processing, and quantify the extent of cellular uptake under different experimental conditions. Through live-cell imaging and quantitative fluorescence analysis, it becomes possible to dissect the factors that govern peptide entry, retention, and distribution within target cells. Such studies are instrumental in deciphering the non-membranolytic functions of LL-37, including its roles in immunomodulation, gene regulation, and cell signaling.

Protein-Protein and Protein-Ligand Interaction Assays: The 5FAM-conjugated LL-37 serves as an excellent reagent for fluorescence-based binding assays, such as fluorescence polarization or Förster resonance energy transfer (FRET). By monitoring changes in fluorescence intensity or polarization upon interaction with target proteins, lipids, or small molecules, researchers can quantify binding affinities, map interaction domains, and screen for potential inhibitors or modulators of LL-37 function. These assays are particularly valuable for characterizing the molecular partners of LL-37 in the extracellular matrix, plasma membranes, or within immune complexes, thus advancing our understanding of its multifaceted biological activities.

Biofilm Penetration and Disruption Studies: The application of 5FAM-labeled LL-37 extends to the investigation of biofilm-associated microbial communities. By leveraging its fluorescent properties, scientists can visualize the penetration depth of the peptide into mature biofilms, assess its distribution within the extracellular polymeric matrix, and quantify the kinetics of biofilm disruption. This approach facilitates the evaluation of LL-37's efficacy against biofilm-embedded pathogens and supports the development of novel anti-biofilm strategies based on peptide engineering or combinatorial treatments.

Host-Pathogen Interaction Models: In complex in vitro models that mimic host-pathogen interactions, the labeled peptide enables precise tracking of LL-37's localization and activity in the presence of both mammalian and microbial cells. Researchers use it to monitor the recruitment of LL-37 to infection sites, investigate its impact on immune cell behavior, and study the modulation of host responses during pathogen challenge. These applications provide valuable insights into the orchestration of innate immunity and the potential for leveraging LL-37 derivatives in therapeutic development. By integrating advanced fluorescence imaging, quantitative analysis, and mechanistic studies, 5FAM label LL 37 (human) empowers researchers to unravel the complexities of antimicrobial defense, cellular communication, and molecular recognition in health and disease.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Analysis ServicesPeptide Synthesis ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers