CAT# | AF2142 |
Sequence | QPPIRNPPPGGWKPFPTFPGQGPYNPKIRFPH |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Antazoline is a drug used in the treatment of atrial fibrillation (AF), and its formula is C17H19N3. In fact, th ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...