Abaecin 1 precursor

CAT#	AF2142
Sequence	QPPIRNPPPGGWKPFPTFPGQGPYNPKIRFPH
Activity	Antimicrobial

Host Chemicals	Solenopsis invicta
Length	32
SwissProt ID	I2E7P4

CAT#	Product Name	M.W	Molecular Formula	Inquiry
AF060	Jellein-2			Inquiry
AF2094	Ranatuerin-2PRb			Inquiry
AF2321	Andersonin-3 peptide precursor			Inquiry
AF2554	Glycine-rich protein GWK			Inquiry
AF2346	Latarcin 7			Inquiry

1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors

2. Immune responses to peptides containing homocitrulline or citrulline in the DR4-transgenic mouse model of rheumatoid arthritis

3. TMEM16F and dynamins control expansive plasma membrane reservoirs

4. Therapeutic potential of an intestinotrophic hormone, glucagon-like peptide 2, for treatment of type 2 short bowel syndrome rats with intestinal bacterial and fungal dysbiosis

5. GLP-1, exendin-4 and C-peptide regulate pancreatic islet microcirculation, insulin secretion and glucose tolerance in rats