CAT# | AF2142 |
Sequence | QPPIRNPPPGGWKPFPTFPGQGPYNPKIRFPH |
Activity | Antimicrobial |
Host Chemicals | Solenopsis invicta | Length | 32 | SwissProt ID | I2E7P4 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2085 | Brevinin-2-RA17 peptide precursor | Inquiry | ||
AF1492 | Panurgine K | Inquiry | ||
AF1109 | Pleurain-D4 | Inquiry | ||
AF1140 | Caerin-4.2 | Inquiry | ||
AF940 | Nigrocin-1-OA3 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...