ACTH (1-39), rat
Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist.
Online Inquiry
| CAT# | HB00086 |
| CAS | 77465-10-2 |
| Synonyms/Alias | ACTH (1-39) (mouse, rat) |
| M.F/Formula | C210H315N57O57S |
| M.W/Mr. | 4582.23 |
| Sequence | One Letter Code: SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Three Letter Code: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
| Storage | Desiccate at -20°C |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for ACTH (1-39), rat
Required fields are marked with *
×
Ask a Question for ACTH (1-39), rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
