Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist.
CAT No: HB00086
CAS No:77465-10-2
Synonyms/Alias:ADRENOCORTICOTROPIC HORMONE RAT;77465-10-2;NSC77465;NSC-77465;FA109432;ACTH (1-39) (mouse, rat) trifluoroacetate salt;636-083-0;H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys -Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-G lu-Ala-Phe-Pro-Leu-Glu-Phe-OH; H-SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH;
ACTH (1-39), rat is a synthetic peptide corresponding to the full-length sequence of adrenocorticotropic hormone derived from rat. As a key component of the hypothalamic-pituitary-adrenal (HPA) axis, this peptide plays a central role in regulating adrenal steroidogenesis and mediating stress responses in mammals. Its structure encompasses the biologically active region responsible for binding to melanocortin receptors, making it highly relevant for studies investigating endocrine signaling, peptide-receptor interactions, and neuroendocrine regulation in rodent models. Due to its sequence fidelity and functional properties, ACTH (1-39), rat is widely utilized in research focused on elucidating the molecular and physiological mechanisms underlying adrenal hormone synthesis and release.
Endocrine signaling research: ACTH (1-39), rat is frequently employed in studies aimed at dissecting the molecular pathways involved in pituitary-adrenal communication. By serving as a direct agonist for melanocortin 2 receptors on adrenocortical cells, it provides a controlled means to stimulate corticosterone and other glucocorticoid production in vitro and in vivo. Researchers leverage this peptide to model the physiological effects of endogenous ACTH, enabling detailed investigations of feedback regulation, receptor specificity, and downstream signaling cascades within the HPA axis.
Peptide-receptor interaction assays: The full-length rat ACTH sequence is an essential reagent in binding studies and functional assays designed to characterize melanocortin receptor activity. Its application allows for the assessment of ligand affinity, receptor activation profiles, and signal transduction efficiency in cellular systems expressing various melanocortin receptor subtypes. These studies contribute to a deeper understanding of peptide hormone-receptor dynamics and facilitate the exploration of structure-activity relationships critical for receptor pharmacology.
Neuroendocrine stress modeling: In behavioral and physiological experiments, ACTH (1-39), rat is utilized to simulate acute or chronic stress conditions in rodent models by inducing endogenous glucocorticoid release. This approach supports research into the neurobiological and systemic consequences of stress, including alterations in immune function, metabolic regulation, and behavioral responses. The peptide's precise sequence ensures reproducibility and relevance in studies exploring the mechanisms of stress adaptation and resilience.
Peptide synthesis and analytical validation: As a well-characterized peptide standard, ACTH (1-39), rat plays a role in the development and validation of synthetic protocols and analytical techniques. Its use as a reference compound in high-performance liquid chromatography (HPLC), mass spectrometry, and other peptide analysis platforms supports method optimization, quality control, and the benchmarking of novel synthetic analogs. This facilitates advancements in peptide chemistry and enhances the reliability of experimental data involving peptide-based reagents.
Comparative physiology studies: The availability of rat-specific ACTH (1-39) enables comparative investigations across species, particularly in studies examining evolutionary differences in HPA axis regulation and adrenal responsiveness. By contrasting the effects of rat ACTH with homologous peptides from other organisms, researchers can explore species-specific adaptations in endocrine signaling, receptor evolution, and stress physiology, yielding insights relevant to both basic biology and translational research contexts.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.