1. Home
  2. Products
  3. Therapeutic Peptides
  4. APIs
  5. ACTH (1-39), rat

ACTH (1-39), rat

Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
ACTH (1-39), rat(CAS 77465-10-2)

CAT No: HB00086

CAS No:77465-10-2

Synonyms/Alias:ADRENOCORTICOTROPIC HORMONE RAT;77465-10-2;NSC77465;NSC-77465;FA109432;ACTH (1-39) (mouse, rat) trifluoroacetate salt;636-083-0;H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys -Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-G lu-Ala-Phe-Pro-Leu-Glu-Phe-OH; H-SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C4H11ClN2O3
M.W/Mr.
170.59
Sequence
Three Letter Code:H-DL-Ser(NH2)-OMe.HCl
Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C4H10N2O3.ClH/c1-8-4(7)3(5)2-9-6;/h3H,2,5-6H2,1H3;1H
InChI Key
GDVXEEKLHYSUSO-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Analysis ServicesEpitope Mapping ServicesPeptide CDMOcGMP Peptide ServiceCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis Services
Hot Products
Elcatonin Acetate

Elcatonin Acetate is a calcitonin analog supporting bone metabolism research. Buy Elcatonin peptide online to study calcium regulation and osteoporosis.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Carperitide

Carperitide is a human atrial natriuretic peptide analog for heart and kidney research. Buy Carperitide peptide online to study diuretic and cardiovascular effects.

Read More Read More
Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) Acetate is a radiolabeled peptide for tumor imaging and targeting research. Purchase this high-purity peptide for oncology and diagnostic studies.

Read More Read More
Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers