ACTH (1-39), rat

Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
ACTH (1-39), rat(CAS 77465-10-2)

CAT No: HB00086

CAS No:77465-10-2

Synonyms/Alias:ADRENOCORTICOTROPIC HORMONE RAT;77465-10-2;NSC77465;NSC-77465;FA109432;ACTH (1-39) (mouse, rat) trifluoroacetate salt;636-083-0;H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys -Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-G lu-Ala-Phe-Pro-Leu-Glu-Phe-OH; H-SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C4H11ClN2O3
M.W/Mr.
170.59
Sequence
Three Letter Code:H-DL-Ser(NH2)-OMe.HCl

ACTH (1-39), rat, also known as adrenocorticotropic hormone (1-39) or corticotropin, is a naturally occurring peptide composed of 39 amino acids derived from the precursor protein pro-opiomelanocortin (POMC). This peptide is specifically sourced from rat sequences, making it highly relevant for rodent-based research models. Its structure closely mirrors endogenous ACTH, enabling it to interact effectively with melanocortin receptors and modulate various physiological processes in vivo and in vitro. Due to its well-characterized sequence and biological activity, ACTH (1-39), rat, serves as a critical reagent for investigating endocrine pathways, stress responses, and molecular mechanisms underlying hormone regulation in laboratory settings.

Endocrine System Research: In the study of pituitary-adrenal axis regulation, ACTH (1-39), rat, is widely employed to probe the secretion of glucocorticoids from the adrenal cortex in rodent models. Researchers utilize this peptide to stimulate adrenal tissue in vitro or administer it in vivo to analyze the dynamic feedback mechanisms that govern hormone release, receptor sensitivity, and downstream signaling. This application provides valuable insights into the molecular underpinnings of stress adaptation, circadian rhythms, and hormonal imbalances associated with various physiological and pathological states.

Neurobiology and Behavior Studies: Corticotropin's influence extends beyond the endocrine system, making it a valuable tool for exploring the neurobiological basis of stress, anxiety, and behavior. Scientists administer it to rodents to trigger stress-like responses, enabling the assessment of neural circuitry, neurotransmitter release, and behavioral phenotypes associated with hypothalamic-pituitary-adrenal (HPA) axis activation. Such studies facilitate a deeper understanding of the interplay between neuroendocrine factors and behavioral outcomes, supporting the development of new strategies for managing stress-related disorders in research contexts.

Immunological Investigations: The immunomodulatory properties of ACTH (1-39), rat, render it a useful agent for examining the crosstalk between the endocrine and immune systems. Researchers utilize this peptide to elucidate how corticotropin influences immune cell function, cytokine production, and inflammatory responses in rodent models. By dissecting these interactions, scientists can better understand the regulatory networks that maintain immune homeostasis and how disruptions may contribute to disease processes, particularly those involving chronic inflammation or autoimmunity.

Metabolic Regulation Studies: In metabolic research, corticotropin is instrumental in dissecting the hormonal control of glucose metabolism, lipid mobilization, and energy balance. Experimental protocols often involve administering the peptide to rodents and monitoring changes in metabolic parameters, gene expression profiles, and tissue-specific responses. These studies illuminate the role of the HPA axis in metabolic adaptation, obesity, and insulin sensitivity, providing a foundation for further exploration of metabolic disorders and their underlying mechanisms.

Pharmacological Screening and Drug Development: ACTH (1-39), rat, is frequently used in preclinical pharmacological studies to evaluate the efficacy and mechanism of action of novel compounds targeting the HPA axis or related pathways. By incorporating this peptide into screening assays, researchers can assess the modulatory effects of candidate drugs on hormone secretion, receptor interactions, and downstream signaling events. This approach accelerates the identification and characterization of new therapeutic agents, supporting translational research and the advancement of endocrine and neuroendocrine pharmacology.

Peptide-based models such as ACTH (1-39), rat, continue to be indispensable in advancing our understanding of complex biological systems. Its versatility in endocrine, neurobiological, immunological, metabolic, and pharmacological research underscores its significance as a foundational tool for experimental studies. By enabling precise manipulation of hormonal pathways and facilitating the dissection of intricate physiological processes, this peptide remains a cornerstone in the toolkit of scientists investigating the multifaceted roles of corticotropin in health and disease.

Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C4H10N2O3.ClH/c1-8-4(7)3(5)2-9-6;/h3H,2,5-6H2,1H3;1H
InChI Key
GDVXEEKLHYSUSO-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesCustom Conjugation ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers