AdTx1
AdTx1 is a 65 amino-acid peptide and a selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). It exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. AdTx1 is used as a potent relaxant of smooth muscles.
Online Inquiry
| CAT# | R1044 |
| Synonyms/Alias | ρ-Da1a |
| M.F/Formula | C310H481N87O100S8 |
| M.W/Mr. | 7283.22 |
| Sequence | LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE(Modifications: Disulfide bridge: 3-24, 17-42, 46-57, 58-63) |
| Labeling Target | α1A adrenoceptor |
| Appearance | Lyophilized solid |
| Purity | >98% |
| Activity | Antagonist |
| Source# | Synthetic |
Storage | -20°C |
Solubility | Soluble in water |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
