AdTx1

AdTx1 is a 65 amino-acid peptide and a selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). It exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. AdTx1 is used as a potent relaxant of smooth muscles.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1044

Synonyms/Alias:ρ-Da1a

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C310H481N87O100S8
M.W/Mr.
7283.22
Sequence
LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE(Modifications: Disulfide bridge: 3-24, 17-42, 46-57, 58-63)
Labeling Target
α1A adrenoceptor
Appearance
Lyophilized solid
Purity
>98%
Activity
Antagonist

AdTx1 is a peptide compound originally identified as a toxin component from the venom of the Agkistrodon contortrix laticinctus, commonly known as the broad-banded copperhead snake. Structurally, it is a disulfide-rich peptide, notable for its highly selective and potent inhibition of acid-sensing ion channel 3 (ASIC3). ASIC3 is a proton-gated ion channel predominantly expressed in sensory neurons, where it plays a crucial role in the detection of acidic environments and the mediation of pain signals. The unique pharmacological profile of AdTx1 makes it a valuable tool in neurobiological research, particularly for elucidating the physiological and pathological roles of ASIC3 and related ion channels.

Electrophysiology research: AdTx1 is widely used in the field of electrophysiology to probe the functional properties of ASIC3 channels. By selectively blocking ASIC3-mediated currents, researchers can dissect the contribution of these channels to neuronal excitability and signal transduction. The peptide's high specificity allows for precise modulation of ASIC3 activity in patch-clamp and voltage-clamp studies, facilitating detailed characterization of ion channel kinetics, gating mechanisms, and pharmacological sensitivities in native or heterologously expressed systems.

Pain signaling studies: As a potent inhibitor of ASIC3, AdTx1 provides a powerful molecular tool for investigating the mechanisms underlying acid-induced pain and nociception. It enables researchers to differentiate ASIC3-dependent pathways from other ion channel-mediated processes in sensory neurons. Through its application in in vitro and ex vivo models, the peptide supports the identification of molecular targets involved in inflammatory pain, tissue acidosis, and mechanotransduction, thereby advancing the understanding of pain physiology at the cellular and molecular levels.

Peptide pharmacology and structure-activity relationship (SAR) analysis: The structural features of AdTx1, including its cysteine-rich motif and disulfide bridges, make it a model compound for SAR studies among venom-derived peptides. Researchers utilize its well-defined sequence to explore the relationship between peptide structure and ASIC3 inhibitory potency. Synthetic analogs and mutagenesis approaches based on AdTx1's scaffold are instrumental in mapping functional domains, optimizing selectivity, and developing novel peptide-based ion channel modulators.

Ion channel screening and drug discovery: In pharmaceutical research, AdTx1 serves as a reference ligand for high-throughput screening assays targeting ASIC3 and related ion channels. Its selective inhibitory action is leveraged to validate assay platforms, benchmark new chemical entities, and identify off-target effects of candidate compounds. This application is particularly relevant in early-stage drug discovery efforts aimed at modulating ion channel activity for research purposes.

Venom peptide mechanism-of-action studies: The use of AdTx1 extends to comparative studies of venom-derived peptides, where it helps elucidate the evolutionary adaptation and functional diversity of ion channel modulators in animal venoms. By serving as a representative ASIC3 inhibitor, it enables the systematic investigation of peptide-toxin interactions with neuronal targets, contributing to a broader understanding of toxin pharmacology and the molecular evolution of venom components.

Collectively, these application directions highlight the scientific utility of AdTx1 as a specialized peptide tool in ion channel research, pain mechanism studies, peptide pharmacology, and venom biology. Its unique properties support a wide range of experimental approaches, making it an indispensable resource for researchers investigating the complex roles of ASIC3 and related ion channels in neurobiology and beyond.

Source#
Synthetic
Long-term Storage Conditions
Soluble in water

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOPeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers