AdTx1 is a 65 amino-acid peptide and a selective, high affinity, non-competitive α1A adrenoceptor antagonist (Ki = 0.35 nM). It exhibits no significant activity against a range of other GPCRs, including α2A, β1 and β2 adrenoceptors. AdTx1 is used as a potent relaxant of smooth muscles.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C310H481N87O100S8 |
M.W/Mr. | 7283.22 |
Sequence | LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE(Modifications: Disulfide bridge: 3-24, 17-42, 46-57, 58-63) |
Labeling Target | α1A adrenoceptor |
Appearance | Lyophilized solid |
Purity | >98% |
Activity | Antagonist |
Source# | Synthetic |
Long-term Storage Conditions | Soluble in water |
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com