AmmTX3

AamTx3 is a blocker of KV4 channel, which blocks A-type K+ current (ISA) in mouse cerebellar granule neurons.

Online Inquiry

CAT#R0861
M.F/FormulaC158H262N50O48S6
M.W/Mr.3822.47
SequenceXIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP(Modifications: X = Glp, Disulfide bridge: 8-28,13-33,17-35)
Labeling TargetKV4 K+ channels
ApplicationBy blocking specifically the Kv4 channels, AmmTX3 reduces the A-type potassium current through these channels almost completely.
Purity>98 %
ActivityBlocker
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

An overview of trifluoroacetyl tripeptide-2  Peptides are chains of amino acids joined by peptide bond. Peptides are mostly i ...

 Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...

 Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.