β-Amyloid (1-42), rat

β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
β-Amyloid (1-42), rat(CAS 166090-74-0)

CAT No: R1766

CAS No:166090-74-0

Synonyms/Alias:166090-74-0;beta-Amyloid (1-42), rat;Amyloid beta-Protein (1-42) (mouse, rat);AKOS024457093;CID 90488761;DA-50450;BETA-AMYLOID (1-42), (RAT/MOUSE);G12431;S-166090-74-0;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C199H307N53O59S
M.W/Mr.
4418
Sequence
One Letter Code:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Three Letter Code:H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

β-Amyloid (1-42), rat is a synthetic peptide corresponding to the 1-42 amino acid sequence of the rat amyloid beta protein. As a key fragment derived from the amyloid precursor protein (APP), it possesses a central role in neurodegenerative disease research, particularly in the context of amyloid aggregation and plaque formation. Structurally, the peptide is characterized by its propensity to form β-sheet-rich fibrils, making it a relevant tool for modeling amyloidogenic processes in vitro and in vivo. Its sequence homology to the endogenous rat peptide allows for species-specific investigations, supporting the development of mechanistic insights into protein misfolding, aggregation, and neurotoxicity pathways that underpin neurological disorders.

Neurodegeneration modeling: The peptide is widely utilized in the establishment of cellular and animal models of amyloid pathology. Researchers employ β-Amyloid (1-42), rat to induce amyloid plaque formation and neurotoxic effects that mirror those observed in age-related neurodegenerative diseases. Such models are instrumental for dissecting the molecular events leading to neuronal dysfunction, synaptic loss, and cognitive decline, providing a robust experimental system for hypothesis-driven studies of disease mechanisms.

Protein aggregation studies: Due to its intrinsic aggregation propensity, the peptide serves as a benchmark substrate in investigations of amyloid fibrillogenesis. Scientists use it to analyze the kinetics of oligomer and fibril formation, evaluate the influence of environmental conditions on aggregation, and assess the structural properties of amyloid assemblies. These studies contribute to a deeper understanding of the physicochemical principles governing protein misfolding and aggregation, which are central to amyloid-related pathologies.

Screening of aggregation modulators: The rat β-amyloid (1-42) peptide is a critical reagent in high-throughput screening assays designed to identify compounds that modulate amyloid aggregation. By providing a reproducible substrate for in vitro aggregation assays, it enables the evaluation of small molecules, peptides, or antibodies for their capacity to inhibit or promote fibril formation. Such screening efforts are foundational for the discovery and characterization of aggregation inhibitors with potential translational relevance in neurodegenerative disease research.

Biophysical and structural analysis: The peptide is frequently employed in studies utilizing techniques such as nuclear magnetic resonance (NMR), circular dichroism (CD) spectroscopy, and electron microscopy to elucidate the conformational dynamics and ultrastructural features of amyloid assemblies. These biophysical investigations shed light on the molecular architecture of oligomeric and fibrillar species, offering key insights into the relationship between peptide structure, aggregation state, and cytotoxicity.

Immunological assay development: β-Amyloid (1-42), rat is also used as a standard or antigen in the development and validation of immunoassays, including enzyme-linked immunosorbent assays (ELISA) and Western blotting protocols. Its defined sequence and aggregation profile make it suitable for generating calibration curves, assessing antibody specificity, and quantifying amyloid species in biological samples. Such applications are essential for advancing biomarker discovery and monitoring disease-relevant amyloid dynamics in experimental systems.

InChI
InChI=1S/C199H307N53O59S/c1-28-105(20)161(191(303)216-91-146(261)223-127(72-97(4)5)179(291)233-126(67-71-312-27)177(289)245-155(99(8)9)189(301)214-86-142(257)210-87-148(263)244-157(101(12)13)194(306)249-160(104(18)19)195(307)252-162(106(21)29-2)196(308)222-111(26)198(310)311)251-197(309)163(107(22)30-3)250-166(278)108(23)219-143(258)88-211-168(280)119(56-43-45-68-200)229-184(296)135(81-141(204)256)239-188(300)139(94-254)226-147(262)92-215-190(302)156(100(10)11)246-187(299)137(83-154(274)275)240-175(287)124(61-65-150(266)267)228-165(277)110(25)221-178(290)131(76-114-52-39-33-40-53-114)237-181(293)132(77-115-54-41-34-42-55-115)242-193(305)159(103(16)17)248-186(298)128(73-98(6)7)235-171(283)120(57-44-46-69-201)230-173(285)122(59-63-140(203)255)231-183(295)134(79-117-85-208-96-218-117)238-172(284)121(58-47-70-209-199(205)206)234-192(304)158(102(14)15)247-176(288)125(62-66-151(268)269)232-180(292)130(75-113-50-37-32-38-51-113)224-144(259)90-213-170(282)138(93-253)243-185(297)136(82-153(272)273)241-182(294)133(78-116-84-207-95-217-116)225-145(260)89-212-169(281)129(74-112-48-35-31-36-49-112)236-174(286)123(60-64-149(264)265)227-164(276)109(24)220-167(279)118(202)80-152(270)271/h31-42,48-55,84-85,95-111,118-139,155-163,253-254H,28-30,43-47,56-83,86-94,200-202H2,1-27H3,(H2,203,255)(H2,204,256)(H,207,217)(H,208,218)(H,210,257)(H,211,280)(H,212,281)(H,213,282)(H,214,301)(H,215,302)(H,216,303)(H,219,258)(H,220,279)(H,221,290)(H,222,308)(H,223,261)(H,224,259)(H,225,260)(H,226,262)(H,227,276)(H,228,277)(H,229,296)(H,230,285)(H,231,295)(H,232,292)(H,233,291)(H,234,304)(H,235,283)(H,236,286)(H,237,293)(H,238,284)(H,239,300)(H,240,287)(H,241,294)(H,242,305)(H,243,297)(H,244,263)(H,245,289)(H,246,299)(H,247,288)(H,248,298)(H,249,306)(H,250,278)(H,251,309)(H,252,307)(H,264,265)(H,266,267)(H,268,269)(H,270,271)(H,272,273)(H,274,275)(H,310,311)(H4,205,206,209)/t105-,106-,107-,108-,109-,110-,111-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,155-,156-,157-,158-,159-,160-,161-,162-,163-/m0/s1
InChI Key
HAWSUONKNKRLRH-QSLPLQOHSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServiceCustom Conjugation ServicePeptide Analysis ServicesPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers