CAT# | AF2341 |
Sequence | CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR |
Activity | Antifungal |
Host Chemicals | Acrocinus longimanus | Length | 34 | SwissProt ID | P83651 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1735 | Grammistin GsA | Inquiry | ||
AF2514 | MMGP1 | Inquiry | ||
AF2534 | Beta defensin 1 | Inquiry | ||
AF3154 | Beta-purothionin | Inquiry | ||
AF2709 | Defensin D7 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...