Home > Product > Antimicrobial Peptides > Antimicrobial peptide Alo-1

Antimicrobial Peptides

Antimicrobial peptide Alo-1

Price Inquiry
CAT#
AF2341
Sequence
CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR
Host Chemicals
Acrocinus longimanus
Length
34
Activity
Antifungal
SwissProt ID
P83651

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.