CAT# | AF2886 |
Sequence | IKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYE |
Activity | Antimicrobial |
Host Chemicals | Bacillus amyloliquefaciens Y2 | Length | 41 | SwissProt ID | I2C153 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF517 | Temporin-1TGc | Inquiry | ||
AF3084 | Ranatuerin-2C antimicrobial peptide | Inquiry | ||
AF072 | Amphipathic peptide Tx348 | Inquiry | ||
AF971 | Nigrosin-OG13 antimicrobial peptide | Inquiry | ||
AF2936 | Eurocin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...