CAT# | A13281 |
M.W/Mr. | 4348.9 |
Sequence | DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...
(d(CH2)51,Tyr(Me)2,Arg8)-vasopressin, a kind of vasopressin, is a prohormone in neurons in the hypothalamus. Vas ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...