Home > Product > Antimicrobial Peptides > Bacteriocin LS2

Antimicrobial Peptides

Bacteriocin LS2

Price Inquiry
CAT#
AF2916
Sequence
TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC
Host Chemicals
Lactobacillus salivarius BGHO1
Length
41
Activity
Antimicrobial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.