CAT# | AF2916 |
Sequence | TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC |
Activity | Antimicrobial |
Host Chemicals | Lactobacillus salivarius BGHO1 | Length | 41 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1666 | Palustrin-1a | Inquiry | ||
AF1929 | Ponericin-G5 | Inquiry | ||
AF1700 | Dinoponeratoxin Da-3105 | Inquiry | ||
AF127 | Myxinidin | Inquiry | ||
AF1801 | Cycloviolacin O21 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...