Home > Product > Catalog Peptides > Modified Amyloids > Beta-Amyloid (1-33)-Ala

Modified Amyloids

Beta-Amyloid (1-33)-Ala

Price Inquiry
CAT#
A13229
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGA
M.W/Mr.
3745.1
Length
34

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.