Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3675 |
Sequence | FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNK |
Length | 32 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.