CAT# | A13216 |
M.W/Mr. | 3556.2 |
Sequence | GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A13034 | Beta-Amyloid (14-23) | Inquiry | ||
A13157 | Beta-Amyloid (12-33), mouse, rat | Inquiry | ||
A13094 | Beta-Amyloid (4-17) | Inquiry | ||
A13256 | [Met]-beta-Amyloid (1-38) | Inquiry | ||
A13212 | Beta-Amyloid (8-40), mouse, rat | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...