Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
Activity | Antibacterial |
Host Chemicals | Bos taurus |
Length | 42 |
SwissProt ID | P46171 |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.