Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD |
Activity | Antibacterial |
Host Chemicals | Gallus gallus |
Length | 41 |
SwissProt ID | Q6IV23 |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.