Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCR |
Activity | Antimicrobial |
Host Chemicals | Pan troglodytes troglodytes |
Length | 36 |
SwissProt ID | Q95JD2 |
1. Emu oil in combination with other active ingredients for treating skin imperfections
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.