Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | TLYRRFLCKKMNGQCEAECFTFEQKIGTCQANFLCCRKRKEH |
Activity | Antibacterial |
Host Chemicals | Mus musculus |
Length | 42 |
SwissProt ID | Q8R2I4 |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.