CAT# | AF2986 |
Sequence | AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDH |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...