Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C189H282N48O56S5 |
M.W/Mr. | 4282.94 |
Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS |
Length | 38 |
4. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.