BNP-45 (51-95) rat 5K Cardiac Natriuretic Peptide
BNP-45 (51-95) rat 5K Cardiac Natriuretic Peptide
Online Inquiry
| CAT# | B1814 |
| M.W/Mr. | 5040.8 |
| Sequence | One Letter Code: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
three Letter Code: H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bridge:23-39) |
| Source# | Synthetic |
Length | 42 |
Storage | -20 ± 5 °C |
Modifications | disulfide |
Write a review
Ask a question
My Review for BNP-45 (51-95) rat 5K Cardiac Natriuretic Peptide
Required fields are marked with *
×
Ask a Question for BNP-45 (51-95) rat 5K Cardiac Natriuretic Peptide
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
