Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 5040.8 |
Sequence | One Letter Code: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39) three Letter Code: H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (Disulfide bridge:23-39) |
Source# | Synthetic |
Length | 42 |
Modifications | disulfide |
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.