BNP-45 rat

BNP-45 (rat), a 45-amino acid brain natriurctic peptide isolated from rat heart, is a circulating hormone, with natriuretic and
hypotensive activities.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1240

CAS No:123337-89-3

Synonyms/Alias:Brain natriuretic peptide-45 rat

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₁₃H₃₄₉N₇₁O₆₅S₃
M.W/Mr.
5040.67
Sequence
One Letter Code: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF(Disulfide bridge: Cys23-Cys39)
three Letter Code: Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe(Disulfide bridge: Cys23-Cys39)

BNP-45 rat is a synthetic peptide corresponding to the 45-amino acid form of brain natriuretic peptide (BNP) derived from rat proBNP. As a member of the natriuretic peptide family, it plays a pivotal role in cardiovascular and renal physiology, modulating processes such as natriuresis, diuresis, and vasodilation through cGMP-mediated signaling pathways. The peptide's sequence and structure make it a valuable tool for researchers investigating peptide-receptor interactions, signal transduction mechanisms, and comparative physiology between species. Its biochemical properties enable precise functional studies in both in vitro and in vivo experimental models, supporting a broad range of peptide-centric research applications.

Receptor binding studies: BNP-45 rat is widely utilized to characterize natriuretic peptide receptor subtypes, particularly NPR-A and NPR-B, in rat tissues and heterologous expression systems. By enabling quantitative and qualitative analysis of ligand-receptor interactions, the peptide supports detailed mapping of binding affinities, receptor selectivity, and downstream signaling events. Such studies are essential for elucidating the molecular mechanisms underlying natriuretic peptide-mediated physiological responses and for advancing the understanding of receptor pharmacology in cardiovascular research.

Signal transduction research: As a potent activator of guanylyl cyclase-linked natriuretic peptide receptors, BNP-45 rat is a standard reagent for probing cGMP-dependent signaling cascades. Researchers employ the peptide to stimulate intracellular cGMP production and assess subsequent effects on ion channel activity, protein kinase G activation, and downstream gene expression. These experiments provide critical insights into the regulation of vascular tone, renal function, and cellular homeostasis, facilitating the exploration of peptide-driven signaling networks in health and disease models.

Comparative physiology studies: The species-specific sequence of BNP-45 rat allows for comparative analysis of natriuretic peptide function across different animal models. By using this peptide in parallel with homologous peptides from other species, investigators can delineate evolutionary conservation and divergence in receptor recognition, biological potency, and tissue distribution. Such comparative studies contribute to a more comprehensive understanding of natriuretic peptide biology and inform translational research involving animal models.

Peptide synthesis and analytical validation: BNP-45 rat serves as a reference standard and positive control in peptide synthesis, purification, and analytical method development. Its well-characterized sequence and established bioactivity enable method validation in mass spectrometry, HPLC, and immunoassay platforms. Laboratories rely on the peptide to optimize synthetic protocols, confirm product identity, and calibrate quantitative assays, ensuring the accuracy and reproducibility of peptide-based experimental workflows.

Functional assays in cardiovascular and renal research: The peptide is frequently employed in functional assays designed to assess natriuretic peptide-mediated physiological effects in isolated organ preparations, tissue cultures, and ex vivo systems. By administering BNP-45 rat, researchers can directly evaluate parameters such as vasorelaxation, natriuresis, and diuretic responses under controlled experimental conditions. These applications are central to dissecting the molecular and cellular basis of cardiovascular and renal regulation, supporting the development of new research hypotheses and experimental models.

Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOPeptide Modification ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers