CAT# | B10006 |
M.W/Mr. | 3464.1 |
Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Length | 32 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
B10007 | BNP-32, porcine | Inquiry | ||
B10009 | BNP-45, mouse | Inquiry | ||
B10010 | Biotinyl-BNP-32 (human) | Inquiry | ||
B10001 | Vasonatrin Peptide (1-27) | Inquiry | ||
B10003 | (Tyr0)-BNP-32 (human) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...