Brain Natriuretic Peptide (BNP) (1-32), rat TFA

Brain Natriuretic Peptide (BNP) (1-32), rat TFA is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1252

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₆H₂₃₉N₄₇O₄₄S₃.C₂HF₃O₂
M.W/Mr.
3566.96
Sequence
One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
three Letter Code: Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26)

Brain Natriuretic Peptide (BNP) (1-32), rat TFA is a synthetic peptide corresponding to the biologically active 32-amino acid sequence of rat BNP, supplied as the trifluoroacetate salt. As a member of the natriuretic peptide family, BNP (1-32) is a key regulator of cardiovascular and renal homeostasis in mammals, acting through specific guanylyl cyclase-coupled natriuretic peptide receptors. Its well-characterized structure and physiological relevance make it a valuable tool for researchers investigating peptide signaling pathways, cardiovascular function, and related molecular mechanisms in rodent models. The availability of this sequence-specific peptide in research-grade form supports a range of biochemical and pharmacological studies focused on cardiac and vascular biology.

Peptide receptor studies: BNP (1-32) is widely utilized in receptor binding and signal transduction assays to elucidate the activity and specificity of natriuretic peptide receptors, particularly NPR-A and NPR-B, in rodent tissues and cell lines. By enabling controlled stimulation of these receptors, the peptide facilitates detailed investigations into downstream cGMP-mediated signaling pathways, receptor pharmacology, and the physiological consequences of natriuretic peptide activation. Such studies are essential for understanding the molecular basis of natriuretic peptide function and for screening potential modulators of these pathways.

Cardiovascular function research: The peptide serves as a critical tool in experimental models of cardiovascular physiology, allowing researchers to examine its effects on cardiac contractility, vascular tone, and hemodynamic parameters in vitro and ex vivo. Application of BNP (1-32) in isolated heart preparations, vascular rings, or perfused organ systems provides insight into the mechanisms underlying natriuresis, vasodilation, and cardiac remodeling. These approaches support the study of heart failure, hypertension, and fluid balance regulation in preclinical research settings.

Renal physiology investigations: BNP (1-32) is employed in studies of kidney function to assess its role in promoting natriuresis, diuresis, and glomerular filtration rate modulation. By administering the peptide to isolated renal tissues or cultured kidney cells, researchers can dissect the direct and indirect actions of natriuretic peptides on renal hemodynamics, tubular transport processes, and electrolyte homeostasis. Such applications are fundamental to understanding the peptide's contribution to fluid and electrolyte balance in mammalian systems.

Peptide structure-activity relationship (SAR) analysis: The defined sequence of rat BNP (1-32) enables its use in structure-activity relationship studies, where systematic modifications or comparisons with related peptides reveal key determinants of receptor binding and biological activity. Researchers utilize this peptide as a reference compound to identify critical residues, secondary structure elements, and post-translational modifications that govern natriuretic peptide function. Insights gained from SAR analyses inform the rational design of novel peptide analogs and receptor agonists for experimental purposes.

Analytical method development: BNP (1-32) is frequently used as a standard or positive control in the development and validation of quantitative analytical techniques, such as enzyme immunoassays, high-performance liquid chromatography (HPLC), and mass spectrometry-based detection methods. Its defined composition and stability make it suitable for calibrating assay sensitivity, specificity, and reproducibility in the measurement of endogenous natriuretic peptides or related biomarkers in biological samples. This application supports the advancement of robust analytical platforms for peptide quantification in research workflows.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOcGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesCustom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers