We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Brain Natriuretic Peptide (BNP) (1-32), rat TFA is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₄₆H₂₃₉N₄₇O₄₄S₃.C₂HF₃O₂ |
M.W/Mr. | 3566.96 |
Sequence | One Letter Code: NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) three Letter Code: Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.