Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | GFMSTFKQVGISAIKGAAKNVLDVLSCKIAKTC |
Activity | Antimicrobial |
Host Chemicals | Amolops jingdongensis |
Length | 33 |
SwissProt ID | K7ZJ56 |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.