Keywords Search Google Search Search

Brevinin-2-AJ4 antimicrobial peptide precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2189
Sequence	GFMSTFKQVGISAIKGAAKNVLDVLSCKIAKTC
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF650	Peptide 2	Inquiry
AF3221	Pyrularia thionin	Inquiry
AF146	E12LLK	Inquiry
AF2246	Brevinin-2-AJ3 antimicrobial peptide precursor	Inquiry
AF1934	Kalata B14	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Conantokin-T, a naturally peptidic NMDA receptor antagonist

Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...

Regulation of secretin on human lower esophageal sphincter

Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Function of Tetracosactide in Adrenal Insufficiency

Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Amolops jingdongensis
Length	33
SwissProt ID	K7ZJ56