Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C338H529N97O105S11 |
M.W/Mr. | 7984.14 |
Sequence | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG(Modifications: Disulfide bridge between 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65) |
Application | Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com