Home > Product > Catalog Peptides > Others > C peptide

Others

C peptide

Price Inquiry
CAT#
A32002
Sequence
SAPEDELAFEDYEDQDYFHPRALSIPSEIEHDNEKESDAFSILSRG
Length
46

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.