Calcitonin salmon

Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.

Online Inquiry

CAT#R1263
Chemical Structure
CAS47931-85-1
Synonyms/AliasSalmon calcitonin
M.F/FormulaC₁₄₅H₂₄₀N₄₄O₄₈S₂
M.W/Mr.3431.85
SequenceOne Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Biological ActivityStimulates bone formation by osteoblasts and inhibits bone resorption.
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...

Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...

  ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

 The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...

 Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2023 Creative Peptides. All rights reserved.