Calcitonin salmon

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#R1263
Chemical Structure
ExplanationCalcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
Synonyms/AliasSalmon calcitonin
M.F/FormulaC₁₄₅H₂₄₀N₄₄O₄₈S₂
M.W/Mr.3431.85
SequenceOne Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Biological ActivityStimulates bone formation by osteoblasts and inhibits bone resorption.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.