Calcitonin salmon

Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Calcitonin salmon(CAS 47931-85-1)

CAT No: R1263

CAS No:47931-85-1

Synonyms/Alias:Salmon calcitonin

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₅H₂₄₀N₄₄O₄₈S₂
M.W/Mr.
3431.85
Sequence
One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7)
Biological Activity
Stimulates bone formation by osteoblasts and inhibits bone resorption.

Calcitonin salmon is a synthetic peptide analog of the naturally occurring hormone calcitonin, originally derived from the salmon species. As a 32-amino acid peptide, it exhibits a high degree of homology with human calcitonin but possesses enhanced potency and stability, making it a valuable tool in biochemical and physiological research. Its primary function involves the regulation of calcium and phosphate metabolism, acting as an inhibitor of osteoclastic bone resorption. Due to its well-characterized structure and defined biological activity, this peptide is widely utilized in studies investigating calcium homeostasis, receptor-ligand interactions, and peptide hormone signaling pathways.

Receptor binding studies: Researchers frequently employ calcitonin salmon to elucidate the molecular mechanisms of peptide hormone-receptor interactions, particularly with the calcitonin receptor (CTR) expressed in osteoclasts and other target tissues. Its high affinity for the CTR, as compared to mammalian calcitonins, allows for detailed kinetic and structure-activity relationship analyses. Such investigations contribute to a deeper understanding of receptor activation, downstream signaling cascades, and the structural determinants of ligand specificity.

Signal transduction research: The peptide is instrumental in dissecting intracellular signaling pathways triggered by calcitonin receptor activation. Upon binding to its receptor, calcitonin salmon initiates a cascade involving cyclic AMP (cAMP) production and protein kinase A (PKA) activation, which ultimately leads to the inhibition of osteoclast-mediated bone resorption. By using this peptide in in vitro systems, scientists can map the specific molecular events and secondary messengers involved, facilitating the identification of novel regulatory nodes within bone and mineral metabolism.

Bone metabolism and resorption assays: Calcitonin salmon serves as a reference compound in assays designed to assess osteoclast function and bone resorption activity. In ex vivo bone organ cultures or cellular models, its inhibitory effects on osteoclasts provide a robust benchmark for evaluating the efficacy of new antiresorptive agents or for studying the pathophysiology of metabolic bone diseases. The peptide's pronounced activity in suppressing bone demineralization makes it a standard tool in both basic and applied bone biology research.

Peptide structure-function analysis: The well-defined sequence and stability of salmon calcitonin make it a preferred model for peptide engineering and structure-function studies. Researchers utilize it to investigate the impact of specific amino acid substitutions, peptide modifications, or conformational changes on biological activity and receptor selectivity. These studies not only enhance understanding of peptide hormone biology but also inform the rational design of analogs with improved pharmacological profiles for research purposes.

Analytical and assay development: Laboratories employ calcitonin salmon as a calibration standard or positive control in immunoassays, receptor binding assays, and biochemical quantification methods. Its consistent biological activity and availability make it suitable for validating assay performance, ensuring reproducibility, and establishing reference ranges in experimental protocols. This application is critical for quality control and method development in both academic and industrial research settings.

Long-term Storage Conditions
Soluble to 1 mg/ml in water
Shipping Condition
Room temperature in continental US; may vary elsewhere.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOCustom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers