Calcitonin salmon
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
Online Inquiry
| CAT# | R1263 |
| Chemical Structure |  |
| CAS | 47931-85-1 |
| Synonyms/Alias | Salmon calcitonin |
| M.F/Formula | C₁₄₅H₂₄₀N₄₄O₄₈S₂ |
| M.W/Mr. | 3431.85 |
| Sequence | One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7)
three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
| Biological Activity | Stimulates bone formation by osteoblasts and inhibits bone resorption. |
| Storage | Desiccate at -20°C |
Solubility | Soluble to 1 mg/ml in water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for Calcitonin salmon
Required fields are marked with *
×
Ask a Question for Calcitonin salmon
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
