Home > Product > Antimicrobial Peptides > Carnobacteriocin B2

Antimicrobial Peptides

Carnobacteriocin B2

Price Inquiry
CAT#
AF2333
Sequence
XNYGNGVSCSKTKCSVNWGQAFQERYTAGINSF
Host Chemicals
Carnobacterium maltaromaticum
Length
33
Activity
Antimicrobial
SwissProt ID
P38580

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.