CAT# | AF2240 |
Sequence | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE |
Activity | Antibacterial |
Host Chemicals | Mus musculus | Length | 33 | SwissProt ID | P51437 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF358 | Temporin-1CSd | Inquiry | ||
AF1444 | XPF-St7 | Inquiry | ||
AF144 | Human Histatin 8 | Inquiry | ||
AF376 | Dinoponeratoxin Da-1585 | Inquiry | ||
AF2313 | Defensin 3 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. Cationic cell-penetrating peptides are potent furin inhibitors
5. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...