Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KCWNLRGSCREKCIKNEKLYIFCTSGKLCCLKPKFQPNMLQR |
Activity | Antibacterial, Antifungal |
Host Chemicals | Canis lupus |
Length | 42 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
3. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.