Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI |
Activity | Antibacterial |
Host Chemicals | Bombyx mori |
Length | 35 |
SwissProt ID | P14666 |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Implications of ligand-receptor binding kinetics on GLP-1R signalling
3. Cationic cell-penetrating peptides are potent furin inhibitors
5. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.