We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RWKVFKKIEKMGRNIRDGVIKAAPAIEVLGQAK |
Activity | Antibacterial, Antifungal |
Host Chemicals | Heliothis virescens |
Length | 33 |
SwissProt ID | P83415 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.