Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SWLSKTYKKLENSAKKRISEGIAIAIQGGPR |
Activity | Antibacterial, Antifungal |
Host Chemicals | Ascaris suum |
Length | 31 |
1. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.