β-CGRP, human TFA

β-CGRP, human TFA is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1795

Synonyms/Alias:Human β-CGRP (TFA); CGRP-II (Human) (TFA)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₆₄H₂₆₈F₃N₅₁O₅₀S₃
M.W/Mr.
3907.38
Sequence
One Letter Code: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)
three Letter Code: Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)

β-CGRP, human TFA is a synthetic peptide corresponding to the human beta isoform of calcitonin gene-related peptide (CGRP), supplied as the trifluoroacetate salt. Recognized as a potent neuropeptide, β-CGRP plays a critical role in vasodilation, sensory neurotransmission, and modulation of inflammatory responses. Its unique sequence and functional properties have made it a valuable tool in neurobiology, cardiovascular research, and peptide signaling studies. As a chemically defined peptide, β-CGRP, human TFA enables researchers to investigate the physiological and pathophysiological processes mediated by the CGRP signaling axis with high specificity and reproducibility.

Neuroscience research: β-CGRP is widely employed in studies dissecting the molecular mechanisms of sensory neuron function and neuropeptide signaling. By serving as a model ligand for CGRP receptors, it facilitates investigations into synaptic transmission, pain pathways, and the regulation of nociceptive signaling. Researchers utilize this peptide to probe receptor-ligand interactions, downstream signaling cascades, and the modulation of neuronal excitability, thereby advancing understanding of neuropeptide-mediated communication within the central and peripheral nervous systems.

Vascular biology: The peptide is instrumental in exploring the role of CGRP in vascular tone regulation and endothelial function. Its potent vasodilatory activity is leveraged to elucidate the mechanisms underlying blood flow modulation, arterial relaxation, and microvascular homeostasis. Experimental applications include ex vivo vessel assays, organ bath studies, and cellular models to assess the impact of CGRP on vascular smooth muscle cells and endothelial cells, supporting research into hypertension, migraine, and cardiovascular physiology.

Inflammation and immune modulation: β-CGRP is utilized to investigate the complex interplay between neuropeptides and immune responses. Its involvement in modulating cytokine release, leukocyte trafficking, and inflammatory mediator production makes it a valuable reagent for characterizing neuroimmune interactions. Experimental models employing this peptide help clarify how CGRP influences tissue inflammation, immune cell behavior, and the resolution of inflammatory processes, providing insight into neurogenic inflammation and related pathologies.

Peptide receptor pharmacology: As a reference ligand, β-CGRP supports the characterization of CGRP receptor subtypes, antagonist screening, and structure-activity relationship studies. Its well-defined sequence and biological activity make it suitable for receptor binding assays, functional response measurements, and the development of novel modulators targeting the CGRP pathway. These applications facilitate drug discovery efforts and the validation of new pharmacological tools for modulating neuropeptide signaling.

Peptide synthesis and analytical validation: In peptide chemistry laboratories, β-CGRP serves as a benchmark for the optimization of solid-phase peptide synthesis protocols and purification strategies. Its defined sequence and analytical profile enable method development for high-performance liquid chromatography (HPLC), mass spectrometry, and peptide quantification. By providing a reliable standard, it assists researchers in ensuring the quality and consistency of peptide production, as well as in validating analytical techniques for peptide characterization.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Analysis ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServicePeptide Synthesis ServicesCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers