Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | RYHMQCGYRGTFCTPGKCPYGNAYLGLCRPKYSCCRWL |
Activity | Antibacterial |
Host Chemicals | Gallus gallus domestic |
Length | 38 |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.