Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3996 |
Sequence | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 |
Length | 36 |
Modifications | disulfide |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Emu oil in combination with other active ingredients for treating skin imperfections
5. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.