CAT# | L07004 |
M.W/Mr. | 4709.7 |
Sequence | CLCLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Length | 40 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
L07006 | KR-12 (human) | Inquiry | ||
L07005 | Biotinyl-LL-37 amide | Inquiry | ||
L07001 | LL-37, Antimicrobial Peptide, human | Inquiry | ||
L07002 | LL-37, reverse sequence | Inquiry | ||
L07008 | LL-37 amide | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...