Keywords Search Google Search Search

Cys-LC-LL-37

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	L07004
M.W/Mr.	4709.7
Sequence	CLCLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

CAT#	Product Name	Inquiry
L07005	Biotinyl-LL-37 amide	Inquiry
L07008	LL-37 amide	Inquiry
L07002	LL-37, reverse sequence	Inquiry
L07006	KR-12 (human)	Inquiry
L07001	LL-37, Antimicrobial Peptide, human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The mechanism and effect of hexapeptide-9

The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

Function of Histrelin Acetate in Prostate Cancer

Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

A brief review of Octreotide

Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: