Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | WDFLKELEGVGQRVRDSIISAGPAIDVLKKSQGPRRWSRP |
Activity | Antibacterial |
Host Chemicals | Lonomia obliqua |
Length | 40 |
SwissProt ID | Q5MGD8 |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.