Home > Product > Antimicrobial Peptides > Defensin, beta 107A

Antimicrobial Peptides

Defensin, beta 107A

Price Inquiry
CAT#
AF3053
Sequence
AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
Host Chemicals
Homo sapiens
Length
44
Activity
Antimicrobial
SwissProt ID
Q8IZN7

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.