Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | AIHRALISKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH |
Activity | Antimicrobial |
Host Chemicals | Homo sapiens |
Length | 44 |
SwissProt ID | Q8IZN7 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.