CAT# | AF2343 |
Sequence | DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
Activity | Antibacterial |
Host Chemicals | Mus musculus | Length | 34 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2377 | Defensin-related cryptdin-23 | Inquiry | ||
AF579 | Venom antimicrobial peptide-9 | Inquiry | ||
AF1360 | Brevinin-1-OR5 | Inquiry | ||
AF3061 | Drosomycin | Inquiry | ||
AF2207 | Brevinin-2Ef | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...